PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0096s0039.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 27098.1 Da    PI: 6.4032
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0096s0039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.12.3e-23958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krie ++nrq+t+skR++g++KKA+ELS+LCd++ a+++fs++++l  +s
  Cagra.0096s0039.1.p  9 KRIEKTTNRQITYSKRKKGLIKKAYELSTLCDIDLALLMFSPSDRLCLFS 58
                         79*****************************************9997765 PP

2K-box18.49e-081071751179
                K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqiee 79 
                          +++ e+l+qe+ +L+k+++  ++e+R++  + +   s++e++  e++L + l+++ +++++ll ++ ++
  Cagra.0096s0039.1.p 107 HTDVEQLEQEVCRLQKQLQISEEELRKFEPDPVRFTSMEEIEACETHLIDTLTRVVQRREHLLNKSCKT 175
                          567899*********************************************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.651161IPR002100Transcription factor, MADS-box
SMARTSM004325.6E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-26282IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-21323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.6E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-212338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-213859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRVKLELKR IEKTTNRQIT YSKRKKGLIK KAYELSTLCD IDLALLMFSP SDRLCLFSGQ  60
TRIEDVFARY INLPDQEREK YYLLRTLEQL KTEDDMALQI NEPRPVHTDV EQLEQEVCRL  120
QKQLQISEEE LRKFEPDPVR FTSMEEIEAC ETHLIDTLTR VVQRREHLLN KSCKTPSTQH  180
SMEGILLNDV SEEWASVTEP KQTHMISNSV HHSNPLRSFL VQTNLFIYLF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-15189190Myocyte-specific enhancer factor 2B
1tqe_R4e-15189190Myocyte-specific enhancer factor 2B
1tqe_Q4e-15189190Myocyte-specific enhancer factor 2B
1tqe_P4e-15189190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0121281e-97BT012128.1 Arabidopsis thaliana At1g77950 mRNA, complete cds.
GenBankBT0123851e-97BT012385.1 Arabidopsis thaliana At1g77950 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301352.11e-141hypothetical protein CARUB_v10021761mg
SwissprotQ9LM468e-93AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLR0I8161e-141R0I816_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__2429__AT1G77950.21e-129(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.21e-129AGAMOUS-like 67